top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|121959323|121961517|3|87,153,29|0,177,2165

NSMCE4A

Open Reading Frame (ORF)

LINLKNLSFKQSLLVLMKKMRDLNITHKLEIKEL

Peptide

MRDLNITHK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

9

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 28 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page