top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|121870005|121924329|3|33,25,64|0,52381,54260

ATE1

Open Reading Frame (ORF)

MWAHSMTVQDYQDLIDRGWRRSGKYVYKPFTRFLCSSPLEACGHIP

Peptide

YVYKPFTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 15 10 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page