top of page

CircRNA

Gene

chr10|112682934|112683109|1|175|0

ENST00000443652.1

Open Reading Frame (ORF)

LHALWKSSQSQNLVPYFYFSFSISKEKAVVNSNFPAGRGKRNFLCVMLCFKNSHHLS

Peptide

NFLCVMLCFK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

10

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

14 17 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page