top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|1124217|1125024|2|107,69|0,738

WDR37

Open Reading Frame (ORF)

LICQECAWRGFPGAADSTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIAKPTSETV

Peptide

GFPGAADSTVTSAVFTVGDNVVSGSDDR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

28

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 23 62 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page