top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|102813076|102813374|1|298|0

WBP1L

Open Reading Frame (ORF)

MPAAEHHQRAGLSQLPEQQLPQLEQVLPAPSNLAKQPGGATMTMTSKSSTHSSMMLWMGPWTSATAAMCGPLVMRRKASVSPLRSRLESLGTRTCHGRPHACC

Peptide

QPGGATMTMTSK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

12

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

8 29 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page