top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|953800|957131|6|92,79,91,121,132,33|0,203,2122,2294,3093,3298

NOC2L

Open Reading Frame (ORF)

LRDGSRQQSNASLQSCSMKWYRRSEQLWPPPEGTRKVLRPTNSRSRTVLHSMLWLPSASETSLAVSRSCCLERWQRIAAGCCSRPAARSGGSFVWTSRLTWARPYSWCPVCRRRRCWRPCCGTSACWCPAS

Peptide

RSEQLWPPPEGTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 40 0 0 0 0 0 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page