top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|66372436|66372706|1|270|0

PDE4B

Open Reading Frame (ORF)

LQQKTSPPWIHNPPLPVEMNILKVPHHHWTSRTGTARV

Peptide

VPHHHWTSRTGTAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

14

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

43 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page