top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|64850645|64850899|1|254|0

JAK1

Open Reading Frame (ORF)

MVVRLLPSKESLPVLFLLRFPQTQPSFPQIPKLLHRGEAGPQLAHTLQP

Peptide

GEAGPQLAHTLQP

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

13

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

39 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page