top of page

CircRNA

Gene

chr1|633733|633818|1|85|0

MTATP6P1

Open Reading Frame (ORF)

LLMRYLEVGINRGGNRMISTAAGRPRISVVDEIFGGGDQ

Peptide

YLEVGINR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

8

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page