top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|51402434|51408332|3|91,171,208|0,984,5690

EPS15

Open Reading Frame (ORF)

LKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSVSLFFSAMSKSILLIYLH

Peptide

LQQETAELEESVESGKAQLEPLQQHLQDSQQEISSVSLFFSAMSK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

45

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

115 21 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Exist in Short-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page