top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|50567076|50596216|3|155,131,96|0,17604,29044

FAF1

Open Reading Frame (ORF)

MCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMSEESFLLSTSTMMKVC

Peptide

KSPMSEESFLLSTSTMMK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

18

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 17 38 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page