top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|45640209|45642499|2|270,73|0,2217

GPBP1L1

Open Reading Frame (ORF)

MQTYWDTFWSMGPLYKLCFMLHNRFDILLSLHSCTSQKTRLVPSNPPRC

Peptide

TRLVPSNPPR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

10

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 31 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page