top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|40984820|40984991|1|171|0

CTPS1

Open Reading Frame (ORF)

LERYTSMSLTRNGKEITWGKLSKVRFLCWMMVGK

Peptide

YTSMSLTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

8

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

25 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page