top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|40422173|40422377|1|204|0

SMAP2

Open Reading Frame (ORF)

LLNKSFGVWHPAQPLPKHEDLSVALCCTCPIAIPTSSPVLSWHQHLRSCWQKALKPHPLFLPLCLV

Peptide

SFGVWHPAQPLPK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

4 36 0 0 0

isoCirc,CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page