top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|40189054|40202614|3|155,82,17|0,1717,13543

RLF

Open Reading Frame (ORF)

LQYASNKNASEHIVYLLEVYRLAIQSFASARPYLTTECEDVLLVLGRLVLSCFELLLSVSESELPCEVWLPFLQSLQKMLLRRPYCNMQATRMHQNILCIFWRYIDLPSKALPVHVHT

Peptide

ALPVHVHT

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

8

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

24 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page