top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|36613303|36613878|3|188,82,46|0,284,529

ENST00000453860

Open Reading Frame (ORF)

LGNFSSLWLPPSHPPGWMASAAWSWSRRETCARAQTLICLLPSS

Peptide

LGNFSSLWLPPSHPPGWMASAAWSWSR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

27

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

82 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page