top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|31586363|31586800|1|437|0

TINAGL1

Open Reading Frame (ORF)

LDPQVREGRWMCGPIELAPRRWVSGGPRFPPLLLTLPPLVPLVPHPLPCWAWVHRLTDVRVREMQRGTETCLSPKGVPNPPKATGGWMGQVSGIGAPESR

Peptide

ATGGWMGQVSGIGAPESR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

18

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

54 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page