top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|27841013|27843330|2|221,145|0,2172

PPP1R8

Open Reading Frame (ORF)

MMRSSTQHTALSWVTFGWNLTSLSKFPSIPRSHLAHPQGHTLCARSLRHCHRL

Peptide

SSTQHTALSWVTFGWNLTSLSKFPSIPR

ORF Found in Short-Read

Peptide Type

ORF Type

true

Junction

Junction

Peptide Length

Frame

Start Codon

28

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 12 73 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page