top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|235054920|235055096|1|176|0

T033420

Open Reading Frame (ORF)

MLEGFPAVPCSGLAFERLQAGGGKVAEAGPRSLRAPQRTLWVH

Peptide

MLEGFPAVPCSGLAFER

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

17

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

52 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page