top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|230839538|230839656|1|118|0

C1orf198

Open Reading Frame (ORF)

LITEVFHLEFLRSVNNSGDLVNKTSVPSSTQLSPSSKD

Peptide

TSVPSSTQLSPSSK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

14

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

43 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page