top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|226383131|226386352|3|52,177,27|0,2372,3194

PARP1

Open Reading Frame (ORF)

LMAWCSVPSFPARNARVSWSSRAMPITALGTSLPGPSVWSRHRHPTGRSG

Peptide

LMAWCSVPSFPARNAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

16

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 49 0 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page