top of page

CircRNA

Gene

chr1|223988273|223988415|1|142|0

ENST00000431663.1

Open Reading Frame (ORF)

MKQGRGKSSIHLSTSQKNNISNVTRKKYAEVRNTELQ

Peptide

NNISNVTRK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

28 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page