top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|212285543|212285784|1|241|0

PPP2R5A

Open Reading Frame (ORF)

LTGKSGHRGSGSEGTRDGSALRGGSRQGGLRWQRPLRCWPAGWLATGAEATRGALGTRTPVPPPQLAGATGQRPGR

Peptide

TPVPPPQLAGATGQRPGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

18

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

23 31 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page