top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|202133784|202133950|1|166|0

ARL8A

Open Reading Frame (ORF)

MPQAGRGLWGPLPSTPSLGRATRLAPAAGTSLGTGGRLPVPCVSTAQSGLSWQCLNATGWQGPLGAPPLDPQPG

Peptide

ATRLAPAAGTSLGTGGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

17

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

8 44 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page