top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|202015222|202015376|1|154|0

ELF3

Open Reading Frame (ORF)

MAGDSSTSLAKTQAAGRRKRFSRVGTEGWNYTRDQTHGPLEACKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN

Peptide

DQTHGPLEACKR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

12

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 3 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page