top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|201383150|201385805|4|61,73,44,105|0,166,1641,2550

LAD1

Open Reading Frame (ORF)

MSSPTQRTYSSSLKRSSPRTISFRMKPKKENSETTLTRSASMKLPDNTVKLGEKLERYHTAIRRSESVKSRGLPCTELFVAPVGENPQQGGRGRYVLTHTANLQQLPQTLQPQDHLLSDETQERKLGNNPNSQCQHEAPRQHSEVGREAGEIPHGHTEIRICQVSGSALH

Peptide

EAGEIPHGHTEIR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

13

1

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 31 9 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page