top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|17648553|17664595|2|45,149|0,15893

ARHGEF10L

Open Reading Frame (ORF)

LWDLESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLEATTLQPQGRRTSQAGYARMRTREVSCGTWRALPCA

Peptide

VTVLEATTLQPQGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

14

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 36 7 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page