top of page

CircRNA

Gene

chr1|16145296|16145570|1|274|0

ENST00000480202

Open Reading Frame (ORF)

LSVSPQGSFPRKPRAQERVKWAEEGRHLPGAVCGRWARCPERSHELCQE

Peptide

HLPGAVCGR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

9

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

28 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page