top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|155438326|155439068|2|44,147|0,595

ASH1L

Open Reading Frame (ORF)

LLQRMVQNEDQEPMEKSIDAVIATASAPPEAITRGRRARE

Peptide

MVQNEDQEPMEKSIDAVIATASAPPEAITR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

30

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

73 18 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page