top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|154582598|154582930|1|332|0

CHRNB2

Open Reading Frame (ORF)

LPWMWVPRLIYCAPSRPRAREQASSTPGDRRHFPTSSLGCFDLGGEWGF

Peptide

EQASSTPGDRR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

11

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page