top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|143745216|143760658|2|97,58|0,15384

ENST00000442049

Open Reading Frame (ORF)

LYFLHKLQHGSISHHLFWSKGRNEHPGNQSSSQRRIPETPPTCLNQISRGSDCTFSTSFSMAVSLTTCFGPRAEMSILETNQVLREEYRRLPRLA

Peptide

LQHGSISHHLFWSK

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

14

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

43 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page