top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|119917664|119917762|1|98|0

NOTCH2

Open Reading Frame (ORF)

LLLKNGANRDMQDNKENLLFTGQLLSIMWRQLFCC

Peptide

DMQDNKENLLFTGQLLSIMWR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

21

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

18 46 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page