top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|117402185|117442325|4|106,41,81,95|0,12605,18383,40045

MAN1A2

Open Reading Frame (ORF)

LAEKLLPAFNTPTGIPWAMVNLKREEEERLRNKIRADHEKALEEAKEKLRKSREEIRAEMGKDGLKTTLISV

Peptide

EEIRAEMGK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

9

1

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

18 10 0 0 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Rescued

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page