top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|116987262|116987501|1|239|0

PTGFRN

Open Reading Frame (ORF)

LLSATLYPADRQHRPVPKANLWLLRPYPTPYPLTCVCL

Peptide

QHRPVPK

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

7

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

TCGA

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page