top of page

CircRNA

Gene

chr1|1044362|1045438|3|77,117,80|0,798,996

AGRN

Open Reading Frame (ORF)

LPRPHLRPAAACGPLTLCPDALRLLPGQYHRSPGRGPGWLPQCLPVQPPWLLRRHL

Peptide

GPGWLPQCLPVQPPWLLR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

18

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 20 35 0 0 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page