top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|1022283|1022453|1|170|0

AGRN

Open Reading Frame (ORF)

LWPAHKNELMLNSSLMRITLRNLEEVEFSALETPSSVTTRCPLGTPGSSL

Peptide

NLEEVEFSALETPSSVTTR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

19

2

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 36 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page