McDonnell Genome Institute

Washington University

Transcript

lnc-ZSWIM9-2:3

Chromosome

chr19

Gene Name

lnc-ZSWIM9-2

Start

48204082

CPC Label

noncoding

End

48213154

Cancer

OV

Strand

+

Peptide

ICTYQNHSK

Modified Peptide

n[145]ICTYQNHSK

Peptide Length

9

ORF Length

113

Open Reading Frame (ORF)

LDLLVQRVWAPGLQSLGEEADAGNLLRSPWLRAAQRAGGGFKGNTEAKRKLLNRKQCQLKILQAKNITENEGEKKMSSEEAKNKRICTYQNHSKRTKKRLSEEVEICRTKFGK

Conservation Score

0.976

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.101244

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3721

PhyloCSF Frame 3

0

CNTI Score

-0.383909078