McDonnell Genome Institute

Washington University

Transcript

lnc-ZSWIM7-4:1

Chromosome

chr17

Gene Name

lnc-ZSWIM7-4

Start

16044451

CPC Label

noncoding

End

16044964

Cancer

OSCC

Strand

-

Peptide

LDQKGSTFTPAALTR

Modified Peptide

n[145]LDQKGSTFTPAALTR

Peptide Length

15

ORF Length

49

Open Reading Frame (ORF)

MRLPMLTLARAIANKLDQKGSTFTPAALTRALILSSVMVTSLSCRVRAE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.0576164

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9312

PhyloCSF Frame 3

0

CNTI Score

-0.324862468