McDonnell Genome Institute

Washington University

Transcript

lnc-ZSWIM2-7:3

Chromosome

chr2

Gene Name

lnc-ZSWIM2-7

Start

185137207

CPC Label

noncoding

End

185167180

Cancer

OV

Strand

-

Peptide

IYARYSATMAKHPNMK

Modified Peptide

n[145]IYARYSATM[147]AKHPNM[147]K

Peptide Length

16

ORF Length

60

Open Reading Frame (ORF)

MITVKFPNELSLGQEILKDTKMADSLLFWRSVLNTHGRIYARYSATMAKHPNMKKMGLNT

Conservation Score

0.076

PhyloCSF Frame 1

-5.538

No. of Spectra

3

CPC Coding Probability

0.0875844

PhyloCSF Frame 2 

-4.819

CNTI Index

noncoding

Max Probability

0.5169

PhyloCSF Frame 3

-5.362

CNTI Score

-0.41332197