McDonnell Genome Institute

Washington University

Transcript

lnc-ZSCAN23-3:3

Chromosome

chr6

Gene Name

lnc-ZSCAN23-3

Start

28484805

CPC Label

noncoding

End

28489490

Cancer

OSCC

Strand

-

Peptide

MQFIFQSPCLMGQAK

Modified Peptide

n[145]MQFIFQSPCLM[147]GQAK

Peptide Length

15

ORF Length

39

Open Reading Frame (ORF)

MQFIFQSPCLMGQAKARLYVRPHLCFVTCSSPSRGSFPQ

Conservation Score

0.883

PhyloCSF Frame 1

-4.705

No. of Spectra

3

CPC Coding Probability

0.0413031

PhyloCSF Frame 2 

-4.885

CNTI Index

noncoding

Max Probability

0.8751

PhyloCSF Frame 3

-4.83

CNTI Score

-0.38280526