McDonnell Genome Institute

Washington University

Transcript

lnc-ZSCAN10-7:1

Chromosome

chr16

Gene Name

lnc-ZSCAN10-7

Start

3140921

CPC Label

noncoding

End

3150540

Cancer

BRCA-Basal-like

Strand

-

Peptide

GWWEGQAR

Modified Peptide

n[145]GWWEGQAR

Peptide Length

8

ORF Length

104

Open Reading Frame (ORF)

LTTHPPALGGSRPGAPGREKLDVRGWWEGQARCQPLLQGTQPGAALSSRSPTRSKRVPPLTKQRLWALLPFTVVGEEWPGEDPESCSAPRSAGAPTVLPEQGRH

Conservation Score

0.364

PhyloCSF Frame 1

-5.033

No. of Spectra

1

CPC Coding Probability

0.33039

PhyloCSF Frame 2 

-4.643

CNTI Index

noncoding

Max Probability

0.2454

PhyloCSF Frame 3

-4.743

CNTI Score

-0.252594873