McDonnell Genome Institute

Washington University

Transcript

lnc-ZSCAN10-3:29

Chromosome

chr16

Gene Name

lnc-ZSCAN10-3

Start

3110511

CPC Label

coding

End

3112489

Cancer

CCRC

Strand

-

Peptide

IVLFEISK

Modified Peptide

n[230]IVLFEISK

Peptide Length

8

ORF Length

128

Open Reading Frame (ORF)

MPAHEDGFTQDAFMMPARQSHQNRKMEDAFCGKIVLFEISKRALQLSSQTEFRSSSHAGVQWRNLSSPQPPPPGFKRFSCLSLLITWDYRHVPPHLANFVFLVEMGFLHVGQAGLELLTSGDPPTSAS

Conservation Score

0.479

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.803046

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

0

CNTI Score

-0.398587813