McDonnell Genome Institute

Washington University

Transcript

lnc-ZSCAN10-1:5

Chromosome

chr16

Gene Name

lnc-ZSCAN10-1

Start

3073509

CPC Label

coding

End

3087109

Cancer

OV

Strand

-

Peptide

AGVMEPQER

Modified Peptide

n[145]AGVM[147]EPQER

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

LLSPKAGVMEPQERTEQNRTGPPAPSLSHRLLLAAKPPLNGGGWSV

Conservation Score

0.264

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.998769

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9248

PhyloCSF Frame 3

0

CNTI Score

-0.327887444