McDonnell Genome Institute

Washington University

Transcript

lnc-ZSCAN1-3:3

Chromosome

chr19

Gene Name

lnc-ZSCAN1-3

Start

58002060

CPC Label

coding

End

58011232

Cancer

OV

Strand

+

Peptide

LTPQAPQLR

Modified Peptide

n[145]LTPQAPQLR

Peptide Length

9

ORF Length

57

Open Reading Frame (ORF)

LTPQAPQLRRPHSLSKGLTSAADNGGCFPGVDRSAPRGLLGAVVPGGHFRRRAAAPP

Conservation Score

1

PhyloCSF Frame 1

0.303

No. of Spectra

3

CPC Coding Probability

0.996052

PhyloCSF Frame 2 

-2.543

CNTI Index

noncoding

Max Probability

0.9962

PhyloCSF Frame 3

-2.255

CNTI Score

-0.262026703