McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF99-5:1

Chromosome

chr19

Gene Name

lnc-ZNF99-5

Start

22708833

CPC Label

noncoding

End

22709314

Cancer

PRAD

Strand

-

Peptide

GAGAALQAGGGDSHAWFLK

Modified Peptide

‚Äč

Peptide Length

19

ORF Length

89

Open Reading Frame (ORF)

LAPQAERTRPGNALVGLGFLRTELGLDAGLQLRRSWARRPRAWALRLLLRFLLCSAGPRLEPAPVRGAGAALQAGGGDSHAWFLKIWPC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0208036

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0965

PhyloCSF Frame 3

0

CNTI Score

-0.290479987