McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF99-2:2

Chromosome

chr19

Gene Name

lnc-ZNF99-2

Start

22520994

CPC Label

noncoding

End

22527949

Cancer

CRC

Strand

-

Peptide

LVFLEERK

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

LVFLEERKRKFKMAVTLRQPLLVVATHLGIFRTF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.283505

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.653

PhyloCSF Frame 3

0

CNTI Score

-0.34325413