McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF98-3:1

Chromosome

chr19

Gene Name

lnc-ZNF98-3

Start

22368598

CPC Label

noncoding

End

22368952

Cancer

EOGC

Strand

-

Peptide

AFLIGEQK

Modified Peptide

n[145]AFLIGEQK

Peptide Length

8

ORF Length

117

Open Reading Frame (ORF)

MVQRLTYQCRLSYNTASNKTRLPRTPGNRIVYLYTKKVGKAPRSASGMCPGRLRGVRAVRPKVLMKLSKRKKHVSRAYGGSMCAKCVRGRIKRAFLIGEQKIVVKVLKAQVQSHKAK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.330556

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4785

PhyloCSF Frame 3

0

CNTI Score

-0.435929178