McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF91-4:5

Chromosome

chr19

Gene Name

lnc-ZNF91-4

Start

23336995

CPC Label

noncoding

End

23345635

Cancer

EOGC

Strand

-

Peptide

LSSLFTGHIHGDK

Modified Peptide

n[145]LSSLFTGHIHGDK

Peptide Length

13

ORF Length

42

Open Reading Frame (ORF)

LSSLFTGHIHGDKTQVLSLDVLQTIFLKLESFMSLVSLLAMQ

Conservation Score

0.02

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0372521

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9389

PhyloCSF Frame 3

0

CNTI Score

-0.351273007