McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF91-1:19

Chromosome

chr19

Gene Name

lnc-ZNF91-1

Start

23525635

CPC Label

noncoding

End

23565523

Cancer

OV

Strand

-

Peptide

IAEGSCSITLR

Modified Peptide

n[145]IAEGSCSITLR

Peptide Length

11

ORF Length

57

Open Reading Frame (ORF)

MWEIGQSGGKRIGKERKFSEMLEGPAELQGRIAEGSCSITLRQRASSRYKGVWKNLS

Conservation Score

0.177

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.233993

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7936

PhyloCSF Frame 3

0

CNTI Score

-0.370087232