McDonnell Genome Institute

Washington University

Transcript

lnc-ZNF836-2:3

Chromosome

chr19

Gene Name

lnc-ZNF836-2

Start

52222224

CPC Label

noncoding

End

52231287

Cancer

OV

Strand

-

Peptide

ISDINQLQHQTSAATEK

Modified Peptide

n[145]ISDINQLQHQTSAATEK

Peptide Length

17

ORF Length

68

Open Reading Frame (ORF)

MTCSIIFYLLCSLGFLLFLCHLEINSFLSIFGKISDINQLQHQTSAATEKARCMEQTKPAAWEIRNHS

Conservation Score

0.241

PhyloCSF Frame 1

-4.208

No. of Spectra

55

CPC Coding Probability

0.04288

PhyloCSF Frame 2 

-3.877

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

-4.274

CNTI Score

-0.38172506